PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_17833-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 215aa    MW: 23669.3 Da    PI: 5.5624
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_17833-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv ++k++G g+W+t ++   + R++k+c++rw +yl
  TRIUR3_17833-P1 14 KGPWTQEEDEKLVAYIKKHGQGNWRTLPKNADLERCGKSCRLRWTNYL 61
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129424.985965IPR017930Myb domain
SMARTSM007177.2E-151363IPR001005SANT/Myb domain
PfamPF002499.7E-161461IPR001005SANT/Myb domain
SuperFamilySSF466892.61E-231588IPR009057Homeodomain-like
CDDcd001672.33E-131661No hitNo description
Gene3DG3DSA:1.10.10.606.6E-86588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MGRAPCCDRT GLKKGPWTQE EDEKLVAYIK KHGQGNWRTL PKNADLERCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNNSA CQMPGLVHAN PAQQLHQDHM VPSDYGQLPG  120
YDNQLELDYV PALMQMASDT SNLQWSSPVT SSNNNNNCNV GSGVSTPSSS PAGRVNSASP  180
TTFCANASNI DAFSADAAGL FDMHLSDLLD VSDYM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-171290582B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2485791e-135AK248579.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf97l09, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560097.16e-58PREDICTED: transcription factor MYB24
TrEMBLM7ZNN81e-163M7ZNN8_TRIUA; Myb-related protein Myb4
STRINGMLOC_62436.16e-62(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-54MYB-like 102